PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005263.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family SRS
Protein Properties Length: 361aa    MW: 40249.6 Da    PI: 7.1836
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005263.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70222.82.6e-074680539
       DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathv 39
                 + +C  CGn a+  C ++ C+ CC      C+ hv
  Aco005263.1 46 KPKCIKCGNVARSRCPFQSCKSCCFKAQNPCHIHV 80
                 568*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.0E-44881IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MATSSPVSSS KGGDSIGSTA AINGNTTPQR TTVIDTPRPN LRGLNKPKCI KCGNVARSRC  60
PFQSCKSCCF KAQNPCHIHV LKQSSILPDK PPPSRSPSIE QPSIDIPSTG SAWRLNALKQ  120
LPHNFLNALR AKKPLNKKDV ANINKWKFAK LREYIEGNIE AENEAFERYL QNVALLEEIF  180
VIPDELKEEN RAAAESTSED KMQRLVSEIK IKLKSNSDKE ESFRERIRNI LDQKLEKLRE  240
KERSNEEGAL SDDLASIKKR GERTAALNDL IDKMNRARGE EDLISCLEMR SQLFRDSASN  300
ATEKCEELNV GDSSACKEEA ETTNSFSYSL PFVCIAVDVD QRMLSDIDAE FASLSRIVEL  360
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237242LREKER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919825.11e-137PREDICTED: uncharacterized protein LOC105043807
RefseqXP_010919826.11e-137PREDICTED: uncharacterized protein LOC105043807
RefseqXP_010919827.11e-137PREDICTED: uncharacterized protein LOC105043807
TrEMBLM0S9151e-122M0S915_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P18240_0011e-121(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP737555
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.11e-76